Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ZPBP2 MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about ZPBP2 MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00124626-B01 |
| Product name: | ZPBP2 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ZPBP2 protein. |
| Gene id: | 124626 |
| Gene name: | ZPBP2 |
| Gene alias: | MGC41930|ZPBPL |
| Gene description: | zona pellucida binding protein 2 |
| Genbank accession: | ENST00000348931 |
| Immunogen: | ZPBP2 (ENSP00000335384, 1 a.a. ~ 315 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MRTCVLLSAVLWCLTGDKIYVELHQNSPVLICMDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQEEKTVKKRYDFMVFAYREPDYSYQMAVRFTTRSCIGRYNDVFFRVLKKILDSLISDLSCHVIEPSYKCHSVEIPEHGLIHELFIAFQVNPFAPGWKGACNGSVDCEDTTNHNILQARDRIEDFFRSQAYIFYHNFNKTLPAMHFVDHSLQVVRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYGAKSCPQTSNKNQQYED |
| Protein accession: | ENSP00000335384 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ZPBP2 expression in transfected 293T cell line (H00124626-T01) by ZPBP2 MaxPab polyclonal antibody. Lane 1: ZPBP2 transfected lysate(34.65 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | The chaperonin containing TCP1 complex (CCT/TRiC) is involved in mediating sperm-oocyte interaction.Dun MD, Smith ND, Baker MA, Lin M, Aitken RJ, Nixon B. J Biol Chem. 2011 Aug 31. [Epub ahead of print] |