| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00124583-M02 |
| Product name: | CANT1 monoclonal antibody (M02), clone 1A1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CANT1. |
| Clone: | 1A1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 124583 |
| Gene name: | CANT1 |
| Gene alias: | SCAN-1|SHAPY |
| Gene description: | calcium activated nucleotidase 1 |
| Genbank accession: | BC017655 |
| Immunogen: | CANT1 (AAH17655, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ASQERYSEKDDERKGANLLLSASPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASYIMAFTLDGRFLLPETKIGSVKYEGIEFI |
| Protein accession: | AAH17655 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of CANT1 expression in transfected 293T cell line by CANT1 monoclonal antibody (M02), clone 1A1. Lane 1: CANT1 transfected lysate(44.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |