Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CANT1 monoclonal antibody (M01), clone 2D3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about CANT1 monoclonal antibody (M01), clone 2D3
| Brand: | Abnova |
| Reference: | H00124583-M01 |
| Product name: | CANT1 monoclonal antibody (M01), clone 2D3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CANT1. |
| Clone: | 2D3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 124583 |
| Gene name: | CANT1 |
| Gene alias: | SCAN-1|SHAPY |
| Gene description: | calcium activated nucleotidase 1 |
| Genbank accession: | BC017655 |
| Immunogen: | CANT1 (AAH17655, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ASQERYSEKDDERKGANLLLSASPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASYIMAFTLDGRFLLPETKIGSVKYEGIEFI |
| Protein accession: | AAH17655 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CANT1 monoclonal antibody (M01), clone 2D3 Western Blot analysis of CANT1 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | ERG rearrangement in small cell prostatic and lung cancer.Scheble VJ, Braun M, Wilbertz T, Stiedl AC, Petersen K, Schilling D, Reischl M, Seitz G, Fend F, Kristiansen G, Perner S. Histopathology. 2010 Jun;56(7):937-43. |