Brand: | Abnova |
Reference: | H00124540-M19 |
Product name: | MSI2 monoclonal antibody (M19), clone 1F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MSI2. |
Clone: | 1F2 |
Isotype: | IgG2b Lambda |
Gene id: | 124540 |
Gene name: | MSI2 |
Gene alias: | FLJ36569|MGC3245|MSI2H |
Gene description: | musashi homolog 2 (Drosophila) |
Genbank accession: | NM_138962 |
Immunogen: | MSI2 (NP_620412, 1 a.a. ~ 85 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHE |
Protein accession: | NP_620412 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.35 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |