Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLIC1 monoclonal antibody (M05), clone 4E9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA |
More info about SLIC1 monoclonal antibody (M05), clone 4E9
| Brand: | Abnova |
| Reference: | H00124460-M05 |
| Product name: | SLIC1 monoclonal antibody (M05), clone 4E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLIC1. |
| Clone: | 4E9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 124460 |
| Gene name: | SNX20 |
| Gene alias: | MGC35578|SLIC-1|SLIC1 |
| Gene description: | sorting nexin 20 |
| Genbank accession: | NM_153337 |
| Immunogen: | SLIC1 (NP_699168.1, 47 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVMGKSRPGEMTYPGSRGETGTAPEPDPRCPRQSDM |
| Protein accession: | NP_699168.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SNX20 is 0.1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |