SENP8 purified MaxPab rabbit polyclonal antibody (D01P) View larger

SENP8 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SENP8 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about SENP8 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00123228-D01P
Product name: SENP8 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human SENP8 protein.
Gene id: 123228
Gene name: SENP8
Gene alias: DEN1|HsT17512|NEDP1|PRSC2
Gene description: SUMO/sentrin specific peptidase family member 8
Genbank accession: NM_145204.2
Immunogen: SENP8 (NP_660205.2, 1 a.a. ~ 212 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK
Protein accession: NP_660205.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00123228-D01P-13-15-1.jpg
Application image note: Western Blot analysis of SENP8 expression in transfected 293T cell line (H00123228-T01) by SENP8 MaxPab polyclonal antibody.

Lane 1: SENP8 transfected lysate(24.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SENP8 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart