Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LRRK2 monoclonal antibody (M01), clone 3B2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about LRRK2 monoclonal antibody (M01), clone 3B2
| Brand: | Abnova |
| Reference: | H00120892-M01 |
| Product name: | LRRK2 monoclonal antibody (M01), clone 3B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LRRK2. |
| Clone: | 3B2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 120892 |
| Gene name: | LRRK2 |
| Gene alias: | AURA17|DARDARIN|PARK8|RIPK7|ROCO2 |
| Gene description: | leucine-rich repeat kinase 2 |
| Genbank accession: | AY792511 |
| Immunogen: | LRRK2 (AAV63975, 2161 a.a. ~ 2260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQK |
| Protein accession: | AAV63975 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged LRRK2 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | LRRK2 regulates autophagic activity and localizes to specific membrane microdomains in a novel human genomic reporter cellular model.Alegre-Abarrategui J, Christian H, Lufino MM, Mutihac R, Venda LL, Ansorge O, Wade-Martins R. Hum Mol Genet. 2009 Nov 1;18(21):4022-34. Epub 2009 Jul 29. |