Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TRIM6 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about TRIM6 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00117854-A01 |
| Product name: | TRIM6 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TRIM6. |
| Gene id: | 117854 |
| Gene name: | TRIM6 |
| Gene alias: | RNF89 |
| Gene description: | tripartite motif-containing 6 |
| Genbank accession: | NM_001003818 |
| Immunogen: | TRIM6 (NP_001003818, 282 a.a. ~ 381 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | DVTERSEFWTLRKPEALPTKLRSMFRAPDLKRMLRVCRELTDVQSYWVDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFSSG |
| Protein accession: | NP_001003818 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | TRIM6 polyclonal antibody (A01), Lot # 051109JC01 Western Blot analysis of TRIM6 expression in PC-12 ( Cat # L012V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |