| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00117581-M20A |
| Product name: | TWIST2 monoclonal antibody (M20A), clone 3B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TWIST2. |
| Clone: | 3B2 |
| Isotype: | IgM Kappa |
| Gene id: | 117581 |
| Gene name: | TWIST2 |
| Gene alias: | DERMO1|MGC117334|bHLHa39 |
| Gene description: | twist homolog 2 (Drosophila) |
| Genbank accession: | NM_057179 |
| Immunogen: | TWIST2 (-, 54 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHER |
| Protein accession: | - |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.57 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of TWIST2 expression in transfected 293T cell line by TWIST2 monoclonal antibody (M20A), clone 3B2. Lane 1: TWIST2 transfected lysate(18.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |