| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00117581-D01P |
| Product name: | TWIST2 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human TWIST2 protein. |
| Gene id: | 117581 |
| Gene name: | TWIST2 |
| Gene alias: | DERMO1|MGC117334|bHLHa39 |
| Gene description: | twist homolog 2 (Drosophila) |
| Genbank accession: | NM_057179.1 |
| Immunogen: | TWIST2 (NP_476527.1, 1 a.a. ~ 160 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH |
| Protein accession: | NP_476527.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of TWIST2 expression in transfected 293T cell line (H00117581-T02) by TWIST2 MaxPab polyclonal antibody. Lane 1: TWIST2 transfected lysate(18.10 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Twist2 contributes to termination of limb bud outgrowth and patterning through direct regulation of Grem1.Wade C, Brinas I, Welfare M, Wicking C, Farlie PG. Dev Biol. 2012 Oct 1;370(1):145-53. Epub 2012 Aug 1. |