Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CENTG3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about CENTG3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00116988-A01 |
| Product name: | CENTG3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CENTG3. |
| Gene id: | 116988 |
| Gene name: | AGAP3 |
| Gene alias: | CENTG3|CRAG|FLJ16146|MRIP-1 |
| Gene description: | ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 |
| Genbank accession: | NM_031946 |
| Immunogen: | CENTG3 (NP_114152, 241 a.a. ~ 338 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VFQDVAQKVVALRKKQQLAIGPCKSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNI |
| Protein accession: | NP_114152 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |