View larger

LRG1 monoclonal antibody (M03), clone 1H1

Reference:

Condition: New product

Data sheet of LRG1 monoclonal antibody (M03), clone 1H1

Brand:	Abnova
Reference:	H00116844-M03
Product name:	LRG1 monoclonal antibody (M03), clone 1H1
Product description:	Mouse monoclonal antibody raised against a full-length recombinant LRG1.
Clone:	1H1
Isotype:	IgG2b Kappa
Gene id:	116844
Gene name:	LRG1
Gene alias:	HMFT1766\|LRG
Gene description:	leucine-rich alpha-2-glycoprotein 1
Genbank accession:	BC034389
Immunogen:	LRG1 (AAH34389, 37 a.a. ~ 347 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	TLSPKDCQVFRPDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQRDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
Protein accession:	AAH34389
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged LRG1 is 0.3 ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA
Shipping condition:	Dry Ice