No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00116844-M03 |
Product name: | LRG1 monoclonal antibody (M03), clone 1H1 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant LRG1. |
Clone: | 1H1 |
Isotype: | IgG2b Kappa |
Gene id: | 116844 |
Gene name: | LRG1 |
Gene alias: | HMFT1766|LRG |
Gene description: | leucine-rich alpha-2-glycoprotein 1 |
Genbank accession: | BC034389 |
Immunogen: | LRG1 (AAH34389, 37 a.a. ~ 347 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TLSPKDCQVFRPDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQRDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ |
Protein accession: | AAH34389 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged LRG1 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |