No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
| Brand: | Abnova |
| Reference: | H00116461-D01P |
| Product name: | C1orf19 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human C1orf19 protein. |
| Gene id: | 116461 |
| Gene name: | TSEN15 |
| Gene alias: | C1orf19|sen15 |
| Gene description: | tRNA splicing endonuclease 15 homolog (S. cerevisiae) |
| Genbank accession: | NM_052965.1 |
| Immunogen: | C1orf19 (NP_443197.1, 1 a.a. ~ 171 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR |
| Protein accession: | NP_443197.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of TSEN15 expression in transfected 293T cell line (H00116461-T02) by TSEN15 MaxPab polyclonal antibody. Lane 1: C1orf19 transfected lysate(18.60 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |