| Brand: | Abnova |
| Reference: | H00116448-M08 |
| Product name: | OLIG1 monoclonal antibody (M08), clone 2A4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant OLIG1. |
| Clone: | 2A4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 116448 |
| Gene name: | OLIG1 |
| Gene alias: | BHLHB6|bHLHe21 |
| Gene description: | oligodendrocyte transcription factor 1 |
| Genbank accession: | NM_138983.1 |
| Immunogen: | OLIG1 (NP_620450.1, 80 a.a. ~ 159 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRAL |
| Protein accession: | NP_620450.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.8 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of OLIG1 transfected lysate using anti-OLIG1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with OLIG1 MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |