Brand: | Abnova |
Reference: | H00116179-A01 |
Product name: | TGM7 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant TGM7. |
Gene id: | 116179 |
Gene name: | TGM7 |
Gene alias: | TGMZ |
Gene description: | transglutaminase 7 |
Genbank accession: | NM_052955 |
Immunogen: | TGM7 (NP_443187, 466 a.a. ~ 565 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MLGPQRASLPFLDLLESGGLRDQPAQLQLHLARIPEWGQDLQLLLRIQRVPDSTHPRGPIGLVVRFCAQALLHGGGTQKPFWRHTVRMNLDFGKETQWPL |
Protein accession: | NP_443187 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TGM7 polyclonal antibody (A01), Lot # 060717JCS1 Western Blot analysis of TGM7 expression in Y-79 ( Cat # L042V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |