| Brand: | Abnova |
| Reference: | H00116173-M02A |
| Product name: | CMTM5 monoclonal antibody (M02A), clone 2B10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CMTM5. |
| Clone: | 2B10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 116173 |
| Gene name: | CMTM5 |
| Gene alias: | CKLFSF5|FLJ37521 |
| Gene description: | CKLF-like MARVEL transmembrane domain containing 5 |
| Genbank accession: | BC013109 |
| Immunogen: | CMTM5 (AAH13109, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ |
| Protein accession: | AAH13109 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |