Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC22A12 monoclonal antibody (M02), clone 2B5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about SLC22A12 monoclonal antibody (M02), clone 2B5
| Brand: | Abnova |
| Reference: | H00116085-M02 |
| Product name: | SLC22A12 monoclonal antibody (M02), clone 2B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC22A12. |
| Clone: | 2B5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 116085 |
| Gene name: | SLC22A12 |
| Gene alias: | OAT4L|RST|URAT1 |
| Gene description: | solute carrier family 22 (organic anion/urate transporter), member 12 |
| Genbank accession: | NM_144585 |
| Immunogen: | SLC22A12 (NP_653186.2, 281 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR |
| Protein accession: | NP_653186.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SLC22A12 monoclonal antibody (M02), clone 2B5. Western Blot analysis of SLC22A12 expression in human stomach. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | OIT3 deficiency impairs uric acid reabsorption in renal tubule.Yan B, Zhang ZZ, Huang LY, Shen HL, Han ZG. FEBS Lett. 2012 Jan 28. [Epub ahead of print] |