RASGRP4 monoclonal antibody (M02), clone 6D3 View larger

RASGRP4 monoclonal antibody (M02), clone 6D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RASGRP4 monoclonal antibody (M02), clone 6D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about RASGRP4 monoclonal antibody (M02), clone 6D3

Brand: Abnova
Reference: H00115727-M02
Product name: RASGRP4 monoclonal antibody (M02), clone 6D3
Product description: Mouse monoclonal antibody raised against a partial recombinant RASGRP4.
Clone: 6D3
Isotype: IgG2a Kappa
Gene id: 115727
Gene name: RASGRP4
Gene alias: -
Gene description: RAS guanyl releasing protein 4
Genbank accession: NM_170603
Immunogen: RASGRP4 (NP_733748, 574 a.a. ~ 673 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CGLCCHKHCRDQVKVECKKRPGAKGDAGPPGAPVPSTPAPHASCGSEENHSYTLSLEPETGCQLRHAWTQTESPHPSWETDTVPCPVMDPPSTASSKLDS
Protein accession: NP_733748
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00115727-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00115727-M02-3-2-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to RASGRP4 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RASGRP4 monoclonal antibody (M02), clone 6D3 now

Add to cart