| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00115708-B01 |
| Product name: | C14orf172 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human C14orf172 protein. |
| Gene id: | 115708 |
| Gene name: | TRMT61A |
| Gene alias: | C14orf172|FLJ40452|GCD14|Gcd14p|TRM61|hTRM61 |
| Gene description: | tRNA methyltransferase 61 homolog A (S. cerevisiae) |
| Genbank accession: | NM_152307 |
| Immunogen: | C14orf172 (NP_689520, 1 a.a. ~ 289 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPAGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG |
| Protein accession: | NP_689520 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of TRMT61A expression in transfected 293T cell line (H00115708-T01) by TRMT61A MaxPab polyclonal antibody. Lane 1: C14orf172 transfected lysate(31.79 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |