C14orf172 MaxPab mouse polyclonal antibody (B01) View larger

C14orf172 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C14orf172 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about C14orf172 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00115708-B01
Product name: C14orf172 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human C14orf172 protein.
Gene id: 115708
Gene name: TRMT61A
Gene alias: C14orf172|FLJ40452|GCD14|Gcd14p|TRM61|hTRM61
Gene description: tRNA methyltransferase 61 homolog A (S. cerevisiae)
Genbank accession: NM_152307
Immunogen: C14orf172 (NP_689520, 1 a.a. ~ 289 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTDGPAGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG
Protein accession: NP_689520
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00115708-B01-13-15-1.jpg
Application image note: Western Blot analysis of TRMT61A expression in transfected 293T cell line (H00115708-T01) by TRMT61A MaxPab polyclonal antibody.

Lane 1: C14orf172 transfected lysate(31.79 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C14orf172 MaxPab mouse polyclonal antibody (B01) now

Add to cart