| Brand: | Abnova |
| Reference: | H00115701-M05 |
| Product name: | ALPK2 monoclonal antibody (M05), clone 4E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ALPK2. |
| Clone: | 4E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 115701 |
| Gene name: | ALPK2 |
| Gene alias: | FLJ34875|FLJ43253|HAK |
| Gene description: | alpha-kinase 2 |
| Genbank accession: | NM_052947 |
| Immunogen: | ALPK2 (NP_443179, 201 a.a. ~ 309 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DGTSSVTEQGRYKLPTAPEAAENDYPGIQGETRDSHQAREEFASDNLLNMDESVRETEMKLLSGESENSGMSQCWETAADKRVGGKDLWSKRGSRKSARVRQPGMKGNP |
| Protein accession: | NP_443179 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | An Alpha-kinase 2 Gene Variant Disrupts Filamentous Actin Localization in the Surface Cells of Colorectal Cancer Spheroids.Nishi K, Luo H, Nakabayashi K, Doi K, Ishikura S, Iwaihara Y, Yoshida Y, Tanisawa K, Arai T, Mori S, Sawabe M, Muramatsu M, Tanaka M, Sakata T, Shirasawa S, Tsunoda T. Anticancer Res. 2017 Jul;37(7):3855-3862. |