| Brand: | Abnova |
| Reference: | H00115265-D01 |
| Product name: | DDIT4L MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human DDIT4L protein. |
| Gene id: | 115265 |
| Gene name: | DDIT4L |
| Gene alias: | REDD2|Rtp801L |
| Gene description: | DNA-damage-inducible transcript 4-like |
| Genbank accession: | NM_145244.2 |
| Immunogen: | DDIT4L (NP_660287.1, 1 a.a. ~ 193 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS |
| Protein accession: | NP_660287.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of DDIT4L transfected lysate using anti-DDIT4L MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with DDIT4L purified MaxPab mouse polyclonal antibody (B01P) (H00115265-B01P). |
| Applications: | WB-Tr,IP |
| Shipping condition: | Dry Ice |