| Brand: | Abnova |
| Reference: | H00114793-M01 |
| Product name: | FMNL2 monoclonal antibody (M01), clone 2B4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant FMNL2. |
| Clone: | 2B4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 114793 |
| Gene name: | FMNL2 |
| Gene alias: | FHOD2|FLJ37546 |
| Gene description: | formin-like 2 |
| Genbank accession: | BC036492 |
| Immunogen: | FMNL2 (AAH36492, 1 a.a. ~ 178 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDLTKREYTMHDHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDGAIEDIITALKKNNITKFPNVHSRVRISSSTPVVEDTQS |
| Protein accession: | AAH36492 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.32 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FMNL2 monoclonal antibody (M01), clone 2B4 Western Blot analysis of FMNL2 expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Epigenetic silencing of miR137 in gastric cancer.Jin W, Jiang T, Sun J, Xu W, Feng L, Jin H, Wang X. Int J Clin Exp Med. 2016 Sep 30;9(9):17926-17932. |