| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00114789-M02 |
| Product name: | SLC25A25 monoclonal antibody (M02), clone 4D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC25A25. |
| Clone: | 4D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 114789 |
| Gene name: | SLC25A25 |
| Gene alias: | KIAA1896|MCSC|MGC105138|MGC119514|MGC119515|MGC119516|MGC119517|PCSCL|RP11-395P17.4|SCAMC-2 |
| Gene description: | solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25 |
| Genbank accession: | NM_052901 |
| Immunogen: | SLC25A25 (NP_443133, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDL |
| Protein accession: | NP_443133 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SLC25A25 expression in transfected 293T cell line by SLC25A25 monoclonal antibody (M02), clone 4D8. Lane 1: SLC25A25 transfected lysate(52.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |