No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00114783-M06A |
| Product name: | LMTK3 monoclonal antibody (M06A), clone 5A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LMTK3. |
| Clone: | 5A10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 114783 |
| Gene name: | LMTK3 |
| Gene alias: | KIAA1883|LMR3|TYKLM3 |
| Gene description: | lemur tyrosine kinase 3 |
| Genbank accession: | XM_055866 |
| Immunogen: | LMTK3 (XP_055866, 1151 a.a. ~ 1250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPG |
| Protein accession: | XP_055866 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |