| Brand: | Abnova |
| Reference: | H00114783-M02 |
| Product name: | LMTK3 monoclonal antibody (M02), clone 2H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LMTK3. |
| Clone: | 2H6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 114783 |
| Gene name: | LMTK3 |
| Gene alias: | KIAA1883|LMR3|TYKLM3 |
| Gene description: | lemur tyrosine kinase 3 |
| Genbank accession: | XM_055866 |
| Immunogen: | LMTK3 (XP_055866, 1151 a.a. ~ 1250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPG |
| Protein accession: | XP_055866 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | LMTK3 monoclonal antibody (M02), clone 2H6 Western Blot analysis of LMTK3 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | LMTK3 Represses Tumor Suppressor-like Genes through Chromatin Remodeling in Breast Cancer.Yichen Xu, Hua Zhang, Van Thuy Mai Nguyen, Nicos Angelopoulos, Joao Nunes, Alistair Reid, Laki Buluwela, Luca Magnani, Justin Stebbing, Georgios Giamas. Cell Rep. 2015 Aug 4;12(5):837-49. |