Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LMTK3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about LMTK3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00114783-A01 |
| Product name: | LMTK3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant LMTK3. |
| Gene id: | 114783 |
| Gene name: | LMTK3 |
| Gene alias: | KIAA1883|LMR3|TYKLM3 |
| Gene description: | lemur tyrosine kinase 3 |
| Genbank accession: | XM_055866 |
| Immunogen: | LMTK3 (XP_055866, 1151 a.a. ~ 1250 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VLVNGGLTPPKSEDKVSENGGLRFPRNTERPPETGPWRAPGPWEKTPESWGPAPTIGEPAPETSLERAPAPSAVVSSRNGGETAPGPLGPAPKNGTLEPG |
| Protein accession: | XP_055866 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | LMTK3 polyclonal antibody (A01), Lot # 060525JCS1 Western Blot analysis of LMTK3 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |