Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CYGB monoclonal antibody (M02), clone 1A1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about CYGB monoclonal antibody (M02), clone 1A1
| Brand: | Abnova |
| Reference: | H00114757-M02 |
| Product name: | CYGB monoclonal antibody (M02), clone 1A1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CYGB. |
| Clone: | 1A1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 114757 |
| Gene name: | CYGB |
| Gene alias: | HGB|STAP |
| Gene description: | cytoglobin |
| Genbank accession: | BC029798 |
| Immunogen: | CYGB (AAH29798, 1 a.a. ~ 190 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP |
| Protein accession: | AAH29798 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (46.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CYGB expression in transfected 293T cell line by CYGB monoclonal antibody (M02), clone 1A1. Lane 1: CYGB transfected lysate(21 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | DNA damage induced activation of Cygb stabilizes p53 and mediates G1 arrest.John R, Chand V, Chakraborty S, Jaiswal N, Nag A DNA Repair (Amst). 2014 Sep 27. pii: S1568-7864(14)00234-1. doi: 10.1016/j.dnarep.2014.09.003. |