| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00114548-M01 |
| Product name: | NLRP3 monoclonal antibody (M01), clone 3B1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NLRP3. |
| Clone: | 3B1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 114548 |
| Gene name: | NLRP3 |
| Gene alias: | AGTAVPRL|AII|AII/AVP|AVP|C1orf7|CIAS1|CLR1.1|FCAS|FCU|FLJ95925|MWS|NALP3|PYPAF1 |
| Gene description: | NLR family, pyrin domain containing 3 |
| Genbank accession: | NM_004895 |
| Immunogen: | NLRP3 (NP_004886, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNAR |
| Protein accession: | NP_004886 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of NLRP3 expression in transfected 293T cell line by NLRP3 monoclonal antibody (M01), clone 3B1. Lane 1: NLRP3 transfected lysate(118.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |