| Brand: | Abnova |
| Reference: | H00114299-M09 |
| Product name: | PALM2 monoclonal antibody (M09), clone 1A8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PALM2. |
| Clone: | 1A8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 114299 |
| Gene name: | PALM2 |
| Gene alias: | AKAP2 |
| Gene description: | paralemmin 2 |
| Genbank accession: | NM_053016 |
| Immunogen: | PALM2 (NP_443749, 321 a.a. ~ 411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EDEEETKKVLGYDETIKAELVLIDEDDEKSLREKTVTDVSTIDGNAAELVSGRPVSDTTEPSSPEGKEESLATEPAPGTQKKKRCQCCVVM |
| Protein accession: | NP_443749 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | PALM2 monoclonal antibody (M09), clone 1A8 Western Blot analysis of PALM2 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |