Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TRIM9 monoclonal antibody (M01), clone 1F12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Tr |
More info about TRIM9 monoclonal antibody (M01), clone 1F12
| Brand: | Abnova |
| Reference: | H00114088-M01 |
| Product name: | TRIM9 monoclonal antibody (M01), clone 1F12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM9. |
| Clone: | 1F12 |
| Isotype: | IgG2b Kappa |
| Gene id: | 114088 |
| Gene name: | TRIM9 |
| Gene alias: | KIAA0282|RNF91|SPRING |
| Gene description: | tripartite motif-containing 9 |
| Genbank accession: | NM_015163.5 |
| Immunogen: | TRIM9 (NP_055978.4, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPP |
| Protein accession: | NP_055978.4 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of TRIM9 expression in transfected 293T cell line by TRIM9 monoclonal antibody (M01), clone 1F12. Lane 1: TRIM9 transfected lysate(61.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | A novel Netrin-1-sensitive mechanism promotes local SNARE-mediated exocytosis during axon branching.Winkle CC, McClain LM, Valtschanoff JG, Park CS, Maglione C, Gupton SL J Cell Biol. 2014 Apr 28;205(2):217-32. doi: 10.1083/jcb.201311003. |