Cart 32 Product Products 11 556,44 € (empty)
-
1 x Bcl-w...259,07 € -
1 x CMTM5...259,07 € -
-
-
-
-
-
-
1 x Bcr...259,07 € -
-
-
-
-
-
1 x Cleaved-Ca...259,07 € -
-
-
-
-
1 x Siah-2...259,07 € -
-
-
-
-
-
-
-
-
-
-
1 x Plakophili...259,07 € -
No products
To be determined Shipping
11 556,44 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 32 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 11 556,44 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 11 556,44 €
Data sheet of DTX2 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about DTX2 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00113878-D01P |
| Product name: | DTX2 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human DTX2 protein. |
| Gene id: | 113878 |
| Gene name: | DTX2 |
| Gene alias: | KIAA1528|MGC71098|RNF58 |
| Gene description: | deltex homolog 2 (Drosophila) |
| Genbank accession: | NM_020892.1 |
| Immunogen: | DTX2 (NP_065943.1, 1 a.a. ~ 622 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAMAPSPSLVQVYTSPAAVAVWEWQDGLGTWHPYSATVCSFIEQQFVQQKGQRFGLGSLAHSIPLGQADPSLAPYIIDLPSWTQFRQDTGTMRAVRRHLFPQHSAPGRGVVWEWLSDDGSWTAYEASVCDYLEQQVARGNQLVDLAPLGYNYTVNYTTHTQTNKTSSFCRSVRRQAGPPYPVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSLSGARSAPRLNTTNAWGAAPPSLGSQPLYRSSLSHLGPQHLPPGSSTSGAVSASLPSGPSSSPGSVPATVPMQMPKPSRVQQALAGMTSVLMSAIGLPVCLSRAPQPTSPPASRLASKSHGSVKRLRKMSVKGATPKPEPEPEQVIKNYTEELKVPPDEDCIICMEKLSAASGYSDVTDSKAIGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQPQGKMEVLRFQMSLPGHEDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNITGHGYPDPNYLQNVLAELAAQGVTEDCLEQQ |
| Protein accession: | NP_065943.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Western Blot analysis of DTX2 expression in transfected 293T cell line (H00113878-T01) by DTX2 MaxPab polyclonal antibody. Lane 1: DTX2 transfected lysate(67.20 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |