| Brand: | Abnova |
| Reference: | H00112858-M06 |
| Product name: | TP53RK monoclonal antibody (M06), clone 2E8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TP53RK. |
| Clone: | 2E8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 112858 |
| Gene name: | TP53RK |
| Gene alias: | BUD32|C20orf64|Nori-2|Nori-2p|PRPK|dJ101A2 |
| Gene description: | TP53 regulating kinase |
| Genbank accession: | BC009727 |
| Immunogen: | TP53RK (AAH09727, 154 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG |
| Protein accession: | AAH09727 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to TP53RK on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |