IL17F MaxPab rabbit polyclonal antibody (D01) View larger

IL17F MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL17F MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Tr,IP

More info about IL17F MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00112744-D01
Product name: IL17F MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human IL17F protein.
Gene id: 112744
Gene name: IL17F
Gene alias: IL-17F|ML-1|ML1
Gene description: interleukin 17F
Genbank accession: NM_052872
Immunogen: IL17F (NP_443104.1, 1 a.a. ~ 163 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Protein accession: NP_443104.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00112744-D01-1-6-1.jpg
Application image note: IL17F MaxPab rabbit polyclonal antibody. Western Blot analysis of IL17F expression in Jurkat.
Applications: WB-Ce,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy IL17F MaxPab rabbit polyclonal antibody (D01) now

Add to cart