| Brand: | Abnova |
| Reference: | H00112744-B01P |
| Product name: | IL17F purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human IL17F protein. |
| Gene id: | 112744 |
| Gene name: | IL17F |
| Gene alias: | IL-17F|ML-1|ML1 |
| Gene description: | interleukin 17F |
| Genbank accession: | NM_052872 |
| Immunogen: | IL17F (NP_443104.1, 1 a.a. ~ 163 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ |
| Protein accession: | NP_443104.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of purified MaxPab antibody to IL17F on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Intratumoral regulatory T cells as an independent predictive factor for pathological complete response to neoadjuvant paclitaxel followed by 5-FU/epirubicin/cyclophosphamide in breast cancer patients.Oda N, Shimazu K, Naoi Y, Morimoto K, Shimomura A, Shimoda M, Kagara N, Maruyama N, Kim SJ, Noguchi S. Breast Cancer Res Treat. 2012 Sep 18. |