> >>CKLFSF7 monoclonal antibody (M01), clone 2B1-G4
CKLFSF7 monoclonal antibody (M01), clone 2B1-G4 View larger

CKLFSF7 monoclonal antibody (M01), clone 2B1-G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of CKLFSF7 monoclonal antibody (M01), clone 2B1-G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about CKLFSF7 monoclonal antibody (M01), clone 2B1-G4

Brand: Abnova
Reference: H00112616-M01
Product name: CKLFSF7 monoclonal antibody (M01), clone 2B1-G4
Product description: Mouse monoclonal antibody raised against a full length recombinant CKLFSF7.
Clone: 2B1-G4
Isotype: IgG1 kappa
Gene id: 112616
Gene name: CMTM7
Gene alias: CKLFSF7|FLJ30992
Gene description: CKLF-like MARVEL transmembrane domain containing 7
Genbank accession: BC010116
Immunogen: CKLFSF7 (AAH10116, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV
Protein accession: AAH10116
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy CKLFSF7 monoclonal antibody (M01), clone 2B1-G4 now

Add to cart