No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
| Brand: | Abnova |
| Reference: | H00112483-B01P |
| Product name: | SAT2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SAT2 protein. |
| Gene id: | 112483 |
| Gene name: | SAT2 |
| Gene alias: | SSAT2 |
| Gene description: | spermidine/spermine N1-acetyltransferase family member 2 |
| Genbank accession: | NM_133491.2 |
| Immunogen: | SAT2 (NP_597998.1, 1 a.a. ~ 170 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK |
| Protein accession: | NP_597998.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of SAT2 expression in transfected 293T cell line (H00112483-T01) by SAT2 MaxPab polyclonal antibody. Lane 1: SAT2 transfected lysate(18.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |