Cart 17 Product Products 5 274,10 € (empty)
No products
To be determined Shipping
5 274,10 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 17 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 274,10 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 274,10 €
Data sheet of PRKCDBP monoclonal antibody (M04), clone 8D3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PRKCDBP monoclonal antibody (M04), clone 8D3
| Brand: | Abnova |
| Reference: | H00112464-M04 |
| Product name: | PRKCDBP monoclonal antibody (M04), clone 8D3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PRKCDBP. |
| Clone: | 8D3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 112464 |
| Gene name: | PRKCDBP |
| Gene alias: | HSRBC|MGC20400|SRBC |
| Gene description: | protein kinase C, delta binding protein |
| Genbank accession: | NM_145040 |
| Immunogen: | PRKCDBP (NP_659477, 161 a.a. ~ 261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPAAPPPTPVKPPRLGPGRSAEAQPEAQPALEPTLEPEPPQDTEEDPGRPGAAEEALLQMESVA |
| Protein accession: | NP_659477 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PRKCDBP expression in transfected 293T cell line by PRKCDBP monoclonal antibody (M04), clone 8D3. Lane 1: PRKCDBP transfected lysate (Predicted MW: 27.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |