Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PRKCDBP polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PRKCDBP polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00112464-A01 |
| Product name: | PRKCDBP polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PRKCDBP. |
| Gene id: | 112464 |
| Gene name: | PRKCDBP |
| Gene alias: | HSRBC|MGC20400|SRBC |
| Gene description: | protein kinase C, delta binding protein |
| Genbank accession: | NM_145040 |
| Immunogen: | PRKCDBP (NP_659477, 161 a.a. ~ 261 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPAAPPPTPVKPPRLGPGRSAEAQPEAQPALEPTLEPEPPQDTEEDPGRPGAAEEALLQMESVA |
| Protein accession: | NP_659477 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.22 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Down-regulation of the cavin family proteins in breast cancer.Bai L, Deng X, Li Q, An W, A D, Gao Z, Xie Y, Dai Y, Cong YS. J Cell Biochem. 2011 Sep 12. doi: 10.1002/jcb.23358. [Epub ahead of print] |