View larger

EGLN3 monoclonal antibody (M01), clone 3C5

Reference:

Condition: New product

Data sheet of EGLN3 monoclonal antibody (M01), clone 3C5

Brand:	Abnova
Reference:	H00112399-M01
Product name:	EGLN3 monoclonal antibody (M01), clone 3C5
Product description:	Mouse monoclonal antibody raised against a partial recombinant EGLN3.
Clone:	3C5
Isotype:	IgG2a Kappa
Gene id:	112399
Gene name:	EGLN3
Gene alias:	FLJ21620\|HIFPH3\|MGC125998\|MGC125999\|PHD3
Gene description:	egl nine homolog 3 (C. elegans)
Genbank accession:	BC010992
Immunogen:	EGLN3 (AAH10992.2, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	EMPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLID
Protein accession:	AAH10992.2
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged EGLN3 is 0.3 ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA
Shipping condition:	Dry Ice