No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00112399-B01P |
Product name: | EGLN3 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human EGLN3 protein. |
Gene id: | 112399 |
Gene name: | EGLN3 |
Gene alias: | FLJ21620|HIFPH3|MGC125998|MGC125999|PHD3 |
Gene description: | egl nine homolog 3 (C. elegans) |
Genbank accession: | NM_022073 |
Immunogen: | EGLN3 (NP_071356.1, 1 a.a. ~ 239 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED |
Protein accession: | NP_071356.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of EGLN3 expression in transfected 293T cell line (H00112399-T01) by EGLN3 MaxPab polyclonal antibody. Lane 1: EGLN3 transfected lysate(26.29 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,IF,WB-Tr |
Shipping condition: | Dry Ice |