No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00094240-M02A |
Product name: | EPSTI1 monoclonal antibody (M02A), clone 3G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EPSTI1. |
Clone: | 3G7 |
Isotype: | IgG1 Kappa |
Gene id: | 94240 |
Gene name: | EPSTI1 |
Gene alias: | BRESI1|MGC29634 |
Gene description: | epithelial stromal interaction 1 (breast) |
Genbank accession: | NM_001002264.1 |
Immunogen: | EPSTI1 (NP_001002264.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLIAPNINRRNEIQRIAEQELANLEKWKEQNRA |
Protein accession: | NP_001002264.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |