Cart 210 Product Products 61 395,31 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Biotin-Lin...434,27 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x FITC-Linke...437,47 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x FITC-Linke...484,42 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Biotin-Lin...410,80 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Biotin-Lin...412,93 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
265,00 € DAP Shipping
61 660,31 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 210 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 61 395,31 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 61 660,31 €
Data sheet of EPSTI1 monoclonal antibody (M02), clone 3G7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about EPSTI1 monoclonal antibody (M02), clone 3G7
| Brand: | Abnova |
| Reference: | H00094240-M02 |
| Product name: | EPSTI1 monoclonal antibody (M02), clone 3G7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EPSTI1. |
| Clone: | 3G7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 94240 |
| Gene name: | EPSTI1 |
| Gene alias: | BRESI1|MGC29634 |
| Gene description: | epithelial stromal interaction 1 (breast) |
| Genbank accession: | NM_001002264 |
| Immunogen: | EPSTI1 (NP_001002264, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLIAPNINRRNEIQRIAEQELANLEKWKEQNRA |
| Protein accession: | NP_001002264 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged EPSTI1 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Epithelial-Stromal Interaction 1 (EPSTI1) Substitutes for Peritumoral Fibroblasts in the Tumor Microenvironment.de Neergaard M, Kim J, Villadsen R, Fridriksdottir AJ, Rank F, Timmermans-Wielenga V, Langerod A, Borresen-Dale AL, Petersen OW, Ronnov-Jessen L. Am J Pathol. 2010 Mar;176(3):1229-40. Epub 2010 Feb 4. |