Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of H2AFV monoclonal antibody (M08), clone 2F9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA |
More info about H2AFV monoclonal antibody (M08), clone 2F9
| Brand: | Abnova |
| Reference: | H00094239-M08 |
| Product name: | H2AFV monoclonal antibody (M08), clone 2F9 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant H2AFV. |
| Clone: | 2F9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 94239 |
| Gene name: | H2AFV |
| Gene alias: | FLJ26479|H2AV|MGC10170|MGC10831|MGC1947 |
| Gene description: | H2A histone family, member V |
| Genbank accession: | BC000098 |
| Immunogen: | H2AFV (AAH00098, 1 a.a. ~ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAGGKAGRDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA |
| Protein accession: | AAH00098 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to H2AFV on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |