Cart 11 Product Products 4 822,00 € (empty)
-
-
-
-
-
-
-
-
1 x Normal Pig...231,00 € -
-
-
No products
To be determined Shipping
4 822,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 11 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 822,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 822,00 €
Data sheet of HSPB9 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about HSPB9 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00094086-B01P |
| Product name: | HSPB9 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human HSPB9 protein. |
| Gene id: | 94086 |
| Gene name: | HSPB9 |
| Gene alias: | FLJ27437 |
| Gene description: | heat shock protein, alpha-crystallin-related, B9 |
| Genbank accession: | NM_033194 |
| Immunogen: | HSPB9 (NP_149971.1, 1 a.a. ~ 159 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MQRVGNTFSNESRVASRCPSVGLAERNRVATMPVRLLRDSPAAQEDNDHARDGFQMKLDAHGFAPEELVVQVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR |
| Protein accession: | NP_149971.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of HSPB9 expression in transfected 293T cell line (H00094086-T01) by HSPB9 MaxPab polyclonal antibody. Lane 1: HSPB9 transfected lysate(17.49 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |