| Brand: | Abnova |
| Reference: | H00094033-M05 |
| Product name: | FTMT monoclonal antibody (M05), clone 6G3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FTMT. |
| Clone: | 6G3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 94033 |
| Gene name: | FTMT |
| Gene alias: | MTF |
| Gene description: | ferritin mitochondrial |
| Genbank accession: | NM_177478 |
| Immunogen: | FTMT (NP_803431.1, 143 a.a. ~ 242 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTLGNENKQN |
| Protein accession: | NP_803431.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FTMT monoclonal antibody (M05), clone 6G3. Western Blot analysis of FTMT expression in MCF-7. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |