| Brand: | Abnova |
| Reference: | H00094027-M01 |
| Product name: | CGB7 monoclonal antibody (M01), clone 6F12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CGB7. |
| Clone: | 6F12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 94027 |
| Gene name: | CGB7 |
| Gene alias: | CG-beta-a|FLJ35403|FLJ43118 |
| Gene description: | chorionic gonadotropin, beta polypeptide 7 |
| Genbank accession: | NM_033142 |
| Immunogen: | CGB7 (NP_149133, 56 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ |
| Protein accession: | NP_149133 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CGB7 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |