CGB7 polyclonal antibody (A01) View larger

CGB7 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CGB7 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CGB7 polyclonal antibody (A01)

Brand: Abnova
Reference: H00094027-A01
Product name: CGB7 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CGB7.
Gene id: 94027
Gene name: CGB7
Gene alias: CG-beta-a|FLJ35403|FLJ43118
Gene description: chorionic gonadotropin, beta polypeptide 7
Genbank accession: NM_033142
Immunogen: CGB7 (NP_149133, 56 a.a. ~ 165 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: GYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ
Protein accession: NP_149133
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00094027-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CGB7 polyclonal antibody (A01) now

Add to cart