No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00094005-M02 |
| Product name: | PIGS monoclonal antibody (M02), clone 3F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PIGS. |
| Clone: | 3F3 |
| Isotype: | IgG2b Kappa |
| Gene id: | 94005 |
| Gene name: | PIGS |
| Gene alias: | DKFZp686K20216|FLJ45226 |
| Gene description: | phosphatidylinositol glycan anchor biosynthesis, class S |
| Genbank accession: | NM_033198 |
| Immunogen: | PIGS (NP_149975.1, 450 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GKISNIVIKDDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQK |
| Protein accession: | NP_149975.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: | ![]() |
| Application image note: | PIGS monoclonal antibody (M02), clone 3F3. Western Blot analysis of PIGS expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |