Cart 1 Product Products 395,00 € (empty)
No products
To be determined Shipping
395,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 395,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 395,00 €
Data sheet of FOXP2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA |
More info about FOXP2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00093986-A01 |
| Product name: | FOXP2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant FOXP2. |
| Gene id: | 93986 |
| Gene name: | FOXP2 |
| Gene alias: | CAGH44|DKFZp686H1726|SPCH1|TNRC10 |
| Gene description: | forkhead box P2 |
| Genbank accession: | NM_014491 |
| Immunogen: | FOXP2 (NP_055306, 616 a.a. ~ 715 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE |
| Protein accession: | NP_055306 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FOXP2 polyclonal antibody (A01), Lot # 050913JC01 Western Blot analysis of FOXP2 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |