No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA |
Brand: | Abnova |
Reference: | H00093986-A01 |
Product name: | FOXP2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant FOXP2. |
Gene id: | 93986 |
Gene name: | FOXP2 |
Gene alias: | CAGH44|DKFZp686H1726|SPCH1|TNRC10 |
Gene description: | forkhead box P2 |
Genbank accession: | NM_014491 |
Immunogen: | FOXP2 (NP_055306, 616 a.a. ~ 715 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | LAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPGCSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE |
Protein accession: | NP_055306 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | FOXP2 polyclonal antibody (A01), Lot # 050913JC01 Western Blot analysis of FOXP2 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |