Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CAPZA3 monoclonal antibody (M01), clone 4D6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA |
More info about CAPZA3 monoclonal antibody (M01), clone 4D6
| Brand: | Abnova |
| Reference: | H00093661-M01 |
| Product name: | CAPZA3 monoclonal antibody (M01), clone 4D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CAPZA3. |
| Clone: | 4D6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 93661 |
| Gene name: | CAPZA3 |
| Gene alias: | CAPPA3|Gsg3 |
| Gene description: | capping protein (actin filament) muscle Z-line, alpha 3 |
| Genbank accession: | NM_033328 |
| Immunogen: | CAPZA3 (NP_201585, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAVLEELQELSNEALRKILRRDLPVTRTLIDWHRILSDLNLVMYPKLGYVIYSRSVLCNWII |
| Protein accession: | NP_201585 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | CAPZA3 monoclonal antibody (M01), clone 4D6. Western Blot analysis of CAPZA3 expression in PC-12 ( Cat # L012V1 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |